PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400048427
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 277aa    MW: 29706.4 Da    PI: 6.5133
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400048427genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822159.13e-49210826133
                DUF822  26 aakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssalaspvesysasp 114
                           aakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg++p+  +e++g+sa+++p+ss + s+ ss++asp++sy++sp
  PGSC0003DMP400048427   2 AAKIYSGLRAQGNYNLPKHCDNNEVLKALCVEAGWIVEPDGTTYRKGCRPT-PMEIGGTSANITPSSSRNPSPPSSYFASPIPSYQPSP 89 
                           9**************************************************.************************************* PP

                DUF822 115 ksssfpspssldsislasa 133
                           +sssfpsps+ d ++++++
  PGSC0003DMP400048427  90 TSSSFPSPSRGDANMSSHP 108
                           ************9988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.4E-462105IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MAAKIYSGLR AQGNYNLPKH CDNNEVLKAL CVEAGWIVEP DGTTYRKGCR PTPMEIGGTS  60
ANITPSSSRN PSPPSSYFAS PIPSYQPSPT SSSFPSPSRG DANMSSHPFA FLHSSIPLSL  120
PPLRISNSAP VTPPLSSPTR VPKQIFNLET LARESMSALN IPFFAASAPT SPTRGQRFTP  180
ATIPECDESD SSTIDSGQWM SFQKYAANGI PTSPTFNLIK PVAQRIPSND MIIDKGKSIE  240
FDFENVSVKA AWEGEKIHEV GLDDLELTLG SGTARM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015160841.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-113BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1CP010.0M1CP01_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000715850.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.26e-98BES1 family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]